PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_004301-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 361aa    MW: 41237.7 Da    PI: 5.298
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_004301-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
    NNU_004301-RA 14 KGLWSPEEDEKLFNHITRFGVGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.31e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E++l++ +++ lG++ W+ Ia  ++ gRt++++k++w++
    NNU_004301-RA  67 RGMFSQQEEDLIISLHQVLGNR-WAQIATQLP-GRTDNEIKNFWNS 110
                      788*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-26664IPR009057Homeodomain-like
PROSITE profilePS5129417.602961IPR017930Myb domain
SuperFamilySSF466891.01E-2811108IPR009057Homeodomain-like
SMARTSM007174.4E-121363IPR001005SANT/Myb domain
PfamPF002491.1E-131461IPR001005SANT/Myb domain
CDDcd001674.20E-101761No hitNo description
PROSITE profilePS5129424.14262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2565116IPR009057Homeodomain-like
SMARTSM007175.6E-1366114IPR001005SANT/Myb domain
PfamPF002491.2E-1367111IPR001005SANT/Myb domain
CDDcd001673.05E-970109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGRHSCCLKQ KLKKGLWSPE EDEKLFNHIT RFGVGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQQEEDLIIS LHQVLGNRWA QIATQLPGRT DNEIKNFWNS CLKKKLRQQG  120
VDPNTHKPLS ETEVREDENK CREADSSSQP KRLRRTSNSE ELGQAFAVNS SIYQDSGLNE  180
ASENKVLTKP VFDPFPFFEF QPGVNPVGDN SNLLSQYHQN FIPLDQTQLA TNFDFGFTSM  240
PRLTNLSETD SSDNNSSSRL SSLFFNGTKE NSSNSSNMNS QTEFQMNNMV STASFSWESG  300
TRLEPMFQFQ LHGIKSEELE LRSWQEDQQQ QTQSSDDFSS FPLTSLSEDL TGVGFDIYEQ  360
I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-28711620128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010251098.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A061FTT71e-154A0A061FTT7_THECC; Myb domain protein 86
STRINGVIT_17s0000g09080.t011e-150(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.39e-82myb domain protein 55